PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P18250_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 479aa    MW: 52130 Da    PI: 5.7413
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P18250_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS216.11.9e-661583471194
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            lv++L++cAeav++++l++a+al++++  la+++g +m+++a yf+eALa+r++r  ++ ++ l+ s+ +    +   + ++ f+e +
  GSMUA_Achr8P18250_001 158 LVHALMACAEAVQQDNLKAADALVKQITVLATSQGGAMRKVAGYFAEALARRIYR--PQPARNLSRSTLDF--PAFDDMLHQHFYESC 241
                            689****************************************************..55555555555543..4555566678***** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P lkf+h+taNqaIlea++g++rvH++Df++ +GlQWpaLlqaLa Rp+gpps+R+Tg+g+p+++++++l+e+g++La+fA++++v+f
  GSMUA_Achr8P18250_001 242 PNLKFAHFTANQAILEAFAGCRRVHVVDFGMREGLQWPALLQALALRPGGPPSFRLTGIGPPQPDHSDALQEVGWKLAQFADTIRVDF 329
                            **************************************************************************************** PP

                   GRAS 177 efnvlvakrledleleeL 194
                            +++ +va +l+dle+ +L
  GSMUA_Achr8P18250_001 330 RYRGFVAASLADLEPYML 347
                            *************99887 PP

2GRAS61.41.9e-19351398226273
                   GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                            +vL +++ ++P++v+vveqea+hn+e+Flerf+eal+yys++fdsle 
  GSMUA_Achr8P18250_001 351 KVLGTIRAMRPRIVTVVEQEANHNGETFLERFTEALHYYSTMFDSLEG 398
                            79********************************************86 PP

3GRAS91.71.2e-28400473302374
                   GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            ga+r+erhe l++Wr r+++aGF+pvp++++a kqa++ll+ ++ +dgyrvee++gsl+lgW++rpL+++SaWr
  GSMUA_Achr8P18250_001 400 GADRTERHEALAQWRVRMGRAGFEPVPIGSNAFKQASMLLALFAgGDGYRVEEKDGSLTLGWHTRPLITTSAWR 473
                            789**********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120413.5E-283199IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011295.7E-2531108No hitNo description
PROSITE profilePS5098538.107132452IPR005202Transcription factor GRAS
PfamPF035146.5E-64158347IPR005202Transcription factor GRAS
PfamPF035146.6E-17351398IPR005202Transcription factor GRAS
PfamPF035144.1E-26400473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MKRERQETVE AAETEDEKGK ARMDADDGGV DELLAALGYK IRSTEMADVA QKLEQLEMAM  60
GSSVAANDDA LLSHLASDAV HYNPSDVSTW QNSTITTVDV PSGPRCPADA YHLEPLHAPA  120
VAGRIVSPPS SSSTTDAATS PAVLPVVVVD TQESGIRLVH ALMACAEAVQ QDNLKAADAL  180
VKQITVLATS QGGAMRKVAG YFAEALARRI YRPQPARNLS RSTLDFPAFD DMLHQHFYES  240
CPNLKFAHFT ANQAILEAFA GCRRVHVVDF GMREGLQWPA LLQALALRPG GPPSFRLTGI  300
GPPQPDHSDA LQEVGWKLAQ FADTIRVDFR YRGFVAASLA DLEPYMLLGP KVLGTIRAMR  360
PRIVTVVEQE ANHNGETFLE RFTEALHYYS TMFDSLEGGG ADRTERHEAL AQWRVRMGRA  420
GFEPVPIGSN AFKQASMLLA LFAGGDGYRV EEKDGSLTLG WHTRPLITTS AWRIASAAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-491584734375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413642.10.0PREDICTED: DELLA protein SLR1-like
SwissprotQ2TN880.0SLR1_ORYSI; DELLA protein SLR1
TrEMBLM0TRH80.0M0TRH8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P18250_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-163GRAS family protein